Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G46880.1
Common NameHB-7, HDG5, HDGL2-5, MQD22.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 826aa    MW: 92120.4 Da    PI: 5.1953
Description homeobox-7
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G46880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t+ q++e+e+lF++n++p+ ++r++L+++lgL+ rqVk+WFqNrR+++k
                  688999***********************************************998 PP

        START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv..........dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                  +a ++ qel k+ + eep+W k            +n++e+++ f+              +  ea++a +vv+m++ +lv  +l+   +W+e++     
                  67899****************999777776554456666666664...03345668999999************************.******99999 PP

        START  78 kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd..seqkppe...sssvvRaellpSgiliepksnghsk 163
                  +a+t++ issg     g l lm+aelq+lsplvp R+ +f+Ry +q  + g w+ivd  +d  ++q++p    ++++ R    pSg++i++++ng+s+
                  **********************************************99**********999444555555556777776...**************** PP

        START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                  v wvehv+++++++h+ +   vksg+a+ga++w+  lqrqce+
                  *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.589109169IPR001356Homeobox domain
SMARTSM003891.3E-18110173IPR001356Homeobox domain
CDDcd000863.77E-19112170No hitNo description
PfamPF000463.6E-18112167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084842.589314558IPR002913START domain
SuperFamilySSF559612.33E-29315557No hitNo description
CDDcd088759.17E-106318554No hitNo description
SMARTSM002344.9E-27323555IPR002913START domain
PfamPF018521.7E-37324555IPR002913START domain
SuperFamilySSF559617.55E-15599802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000018anatomyovule primordium
PO:0000037anatomyshoot apex
PO:0000229anatomyflower meristem
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0004011anatomyinitial cell
PO:0006035anatomyshoot system epidermis
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009052anatomyflower pedicel
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT5G46880-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in the L1 of apical inflorescence meristems, early flower primordia, carpel and stamen filament epidermis, ovule primordia, nucellus and chalaze. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G46880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0133940.0AB013394.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQD22.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199499.30.0homeobox-leucine zipper protein HDG5
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLR0GUB60.0R0GUB6_9BRAS; Uncharacterized protein
STRINGAT5G46880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP94751113
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
  4. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
  5. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
  7. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
  8. Son O, et al.
    Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.
    Biochem. Biophys. Res. Commun., 2005. 326(1): p. 203-9
  9. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
  10. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
  11. Kamata N,Okada H,Komeda Y,Takahashi T
    Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.
    Plant J., 2013. 75(3): p. 430-40